| Basic Information | |
|---|---|
| Taxon OID | 3300010110 Open in IMG/M |
| Scaffold ID | Ga0126316_1001229 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 535 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fluxnet siteBondville, Illinois | |||||||
| Coordinates | Lat. (o) | 40.0062 | Long. (o) | -88.2904 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001233 | Metagenome / Metatranscriptome | 741 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126316_10012292 | F001233 | N/A | LRWAAAVNRLKLNVSRIIPGDWGKVEPGWLAQLLLSWIARSGSGGRIHQFLWRRSRAVSNAKRD* |
| ⦗Top⦘ |