| Basic Information | |
|---|---|
| Taxon OID | 3300010051 Open in IMG/M |
| Scaffold ID | Ga0133939_1122486 Open in IMG/M |
| Source Dataset Name | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aalborg University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2077 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater → Industrial Wastewater Microbial Communities From Reactors Of Effluent Treatment Plant In South Killingholme, Immingham, England |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Killingholme, Immingham, South Humberside, DN40 3DW, England | |||||||
| Coordinates | Lat. (o) | 53.633367 | Long. (o) | -0.251861 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041657 | Metagenome / Metatranscriptome | 159 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0133939_11224863 | F041657 | GGAG | MSYDPPASNASTALSRERKTRLPGWRAILVRDETFARLQSIQASTVDPHLDLRYIGDATVLLTLDELSPAHIVKRAVDEMKRRL* |
| ⦗Top⦘ |