Scaffold Ga0126384_12283590

Overview

Basic Information

• Taxon OID: 3300010046
• Scaffold ID: Ga0126384_12283590
• Source Dataset Name: Tropical forest soil microbial communities from Panama - MetaG Plot_36
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location

• Location Name: Panama
• Coordinates
  • Lat. (^o): 9.1086
  • Long. (^o): -79.8436
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035927	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126384_122835901	F035927	GAG	MVTIKIKDGTPQGTETLCLTCRWAHIVKGFSASQEQIRCRWLSNDLLVPFPVSECSSYDDKRLPSKNDMEKIAWVLLTKKAGRTIGFVTAKQFREIEGDDAEIIPAASSSADTKE*