Scaffold Ga0126384_10761073

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126384_10761073

Scaffold Ga0126384_10761073

Overview

Basic Information
Taxon OID	3300010046 Open in IMG/M
Scaffold ID	Ga0126384_10761073 Open in IMG/M
Source Dataset Name	Tropical forest soil microbial communities from Panama - MetaG Plot_36
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	864
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location Name	Panama
Coordinates	Lat. (^o)	9.1086	Long. (^o)	-79.8436	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031740	Metagenome / Metatranscriptome	181	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126384_107610733	F031740	N/A	CDPEYTAHREAQKRRQQTREWLLQRERANIAPSIVPDVPEAEQQRERGPPYSHSRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.