NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126310_10394627

Scaffold Ga0126310_10394627


Overview

Basic Information
Taxon OID3300010044 Open in IMG/M
Scaffold IDGa0126310_10394627 Open in IMG/M
Source Dataset NameSerpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)983
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location NameUC McLaughlin Reserve (Lake County, CA)
CoordinatesLat. (o)38.8711Long. (o)-122.4276Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011708Metagenome288Y

Sequences

Protein IDFamilyRBSSequence
Ga0126310_103946271F011708GGAGMQCPACYSEIDDRSYRCNRCRRISSYRRLWWRYRYLALIVGVLIGLWTIPGLVRRWFTRGYDKLPPGALVSDATTMGWLRLTDKEWFCEEPHYKGNLLHLRHKVFQAKDVIVFVHGFIGDYVNTWGNPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.