NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126343_10867511

Scaffold Ga0126343_10867511


Overview

Basic Information
Taxon OID3300010035 Open in IMG/M
Scaffold IDGa0126343_10867511 Open in IMG/M
Source Dataset NameCoral microbial communities from Lord Howe Island, Old Settlement Bay, Australia - Cyphastrea 2 metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)558
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NameLord Howe Island, Old Settlement Bay, Australia
CoordinatesLat. (o)-31.55Long. (o)159.0833Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032531Metagenome / Metatranscriptome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0126343_108675111F032531GAGMHDRRHHYKIFHPRFKMAESFENLDHILHDWEKDKNKKSIVEALNRYEKHSLAGKRMIKPFSFLEN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.