Basic Information | |
---|---|
Taxon OID | 3300010035 Open in IMG/M |
Scaffold ID | Ga0126343_10159618 Open in IMG/M |
Source Dataset Name | Coral microbial communities from Lord Howe Island, Old Settlement Bay, Australia - Cyphastrea 2 metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1599 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lord Howe Island, Old Settlement Bay, Australia | |||||||
Coordinates | Lat. (o) | -31.55 | Long. (o) | 159.0833 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024250 | Metagenome / Metatranscriptome | 206 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0126343_101596181 | F024250 | N/A | GLIVAPWKFDVLKTSIFALEASLLGQIFVLRTSNFCGATITNFCGATISR* |
⦗Top⦘ |