Scaffold Ga0126343_10069321

Overview

Basic Information

• Taxon OID: 3300010035
• Scaffold ID: Ga0126343_10069321
• Source Dataset Name: Coral microbial communities from Lord Howe Island, Old Settlement Bay, Australia - Cyphastrea 2 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2503
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location

• Location Name: Lord Howe Island, Old Settlement Bay, Australia
• Coordinates
  • Lat. (^o): -31.55
  • Long. (^o): 159.0833
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032531	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126343_100693211	F032531	GAG	MHDCRHHCKVFLLRFKMAESFENLENILHDWAKDKNKKGIVEALNRYEKHSLAGKRKINPFSFLENGTEKILQQSALERD*