Scaffold Ga0126342_10030326

Overview

Basic Information

• Taxon OID: 3300010034
• Scaffold ID: Ga0126342_10030326
• Source Dataset Name: Coral microbial communities from Lord Howe Island, Old Settlement Bay, Australia - Cyphastrea 1 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8209
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (30.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location

• Location Name: Lord Howe Island, Old Settlement Bay, Australia
• Coordinates
  • Lat. (^o): -31.55
  • Long. (^o): 159.0833
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019069	Metagenome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126342_1003032610	F019069	N/A	MICGSGGSKRLAKAAGAEPSGQMKDEKLHDVVAPSTFRSQNVQSTP