Scaffold Ga0126339_10085019

Overview

Basic Information

• Taxon OID: 3300010033
• Scaffold ID: Ga0126339_10085019
• Source Dataset Name: Coral microbial communities from Petempiche,Puerto Morelos, Mexico - Orbicella T R C metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1595
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location

• Location Name: Petempiche,Puerto Morelos, Mexico
• Coordinates
  • Lat. (^o): 20.9047
  • Long. (^o): -86.8366
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054574	Metagenome / Metatranscriptome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126339_100850192	F054574	GGA	MLVHPRVTPSIKFAGTHLYIWVERGTVRVKCLAQEHNTMSPARAR