NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126338_10020824

Scaffold Ga0126338_10020824


Overview

Basic Information
Taxon OID3300010030 Open in IMG/M
Scaffold IDGa0126338_10020824 Open in IMG/M
Source Dataset NameCoral microbial communities from Petempiche,Puerto Morelos, Mexico - Orbicella C C metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4361
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (22.22%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NamePetempiche,Puerto Morelos, Mexico
CoordinatesLat. (o)20.9047Long. (o)-86.8366Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019780Metagenome / Metatranscriptome227Y
F021048Metagenome / Metatranscriptome220Y
F024251Metagenome / Metatranscriptome206Y
F091323Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0126338_100208241F024251N/ALKKDWKNCTVYTPTWLPQDIRPTFCKQSTVNFPRASKNLPPELREIIYKEYIEIKRREKKEMGWDKVQEHISKLPFCQYRQQIAPMIICLEYPYCYFEGCCFPCFEREGALHKASLSPPMELIPLIEASPEYKNFLKVCSWDGYNWHEWFLFGRER*
Ga0126338_100208245F021048N/AMVVLTIVTQENGQTIYFEEPIPKVHFMKLISCSLFNSWDTLKKEGSATLGDKDKDIALSISKIMPGHYSLERMAKEIKGLLDKYGYKHLETEINQPVGQLVIRHFGAGTKPIELDRDLANLLGIGRKLKAITFVKRLTSTTTYFIHCDLIDTEKNLFNGKKTDVLAMFDIKGKPFEKVSYQGSPQQVLRDCSTDDFINSITISVKYENGELFDFKGFPLLFELELN*
Ga0126338_100208246F091323N/AMANLWKDPEFLKKAAIAKEKAWTNLLNHFPKADKSRFVSQERIDEKNNATAEVFFKESEGSFQSVFGSDRRYWSAEMKKAFGLGDSGGFPYQLSPLGSKVSLPIPAEPFDGKAPSLKKTFNAEIKIYVTHDKYFTTKL*
Ga0126338_100208248F019780N/AVTLTAVLLAAGVTIGSAIGALTRGLKATSKALGEGLQDIGSKLASLLPGLIGSIGSFLFKAADQVVGFLAEHTWLLILALVAFLFEEYFKKQR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.