Scaffold Ga0130028_104789

Overview

Basic Information

• Taxon OID: 3300010023
• Scaffold ID: Ga0130028_104789
• Source Dataset Name: Terrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Duke University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 606
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat → Terrestrial Hot Spring Microbial Mat Viral Communities From Octopus Spring, Yellowstone National Park, Wyoming

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming
• Coordinates
  • Lat. (^o): 44.53408
  • Long. (^o): -110.7979

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041223	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0130028_1047892	F041223	GGGGG	MTPKVCLIVREFGLFNRAWLQVLRNLGIDYTLCIATSGATSANIQTPQGVFAASG