| Basic Information | |
|---|---|
| Taxon OID | 3300010023 Open in IMG/M |
| Scaffold ID | Ga0130028_100001 Open in IMG/M |
| Source Dataset Name | Terrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Duke University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 16155 |
| Total Scaffold Genes | 19 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (57.89%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat → Terrestrial Hot Spring Microbial Mat Viral Communities From Octopus Spring, Yellowstone National Park, Wyoming |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming | |||||||
| Coordinates | Lat. (o) | 44.53408 | Long. (o) | -110.7979 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068875 | Metagenome / Metatranscriptome | 124 | N |
| F081384 | Metagenome / Metatranscriptome | 114 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0130028_1000014 | F081384 | N/A | MLIEPSDFGGEYRLFNANNLDPDTIRAIDQAQEELARDLFPIGYSFIISNLPSDPPNLGLRMLGLHKLFVPWVFLRLELGILGAGVKRASDVPGRSRFASGAFFAIAREYKYFLGAWLEHEGYIGAIAVSSTLIAVPIVASQIVAPGMEIEIEGIGKYSVVASASGLLTISPALPAGVSNLRFRQISLRIDRKWNYL* |
| Ga0130028_1000018 | F068875 | N/A | MAPIVKLIFTTRVNQLITDPATQLELSPTNTNFPDIYRLITPRLDDVSSERPEAITEEIGATTYYVRDAARTITATVGQLPTEWAQRVAELRCQAEVGVFLVDANGTIWGRKVDTPTGVAGAPLPIVPSSIDARFAFPSYSSVQKHIITFQLPFTLADYEIIPLWNNQAVLNNSAPQPVGFRVFQEAGNWVVFLFTKYHAPNGTIVVPIANVANPADIDIYNASGTTLVASGSTNLGGGKYALNNPLTTGTQYILDCTAITSPPRTQFDWPALRVPFRA* |
| ⦗Top⦘ |