| Basic Information | |
|---|---|
| Taxon OID | 3300010021 Open in IMG/M |
| Scaffold ID | Ga0133905_1092001 Open in IMG/M |
| Source Dataset Name | Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #3 sample T3 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 552 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Belize: Carrie Bow Cay Field Station | |||||||
| Coordinates | Lat. (o) | 16.80288 | Long. (o) | -88.08213 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012646 | Metagenome / Metatranscriptome | 278 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0133905_10920011 | F012646 | N/A | KQQVNPETKKAALKLMAGGPSKINPPNSHPSNPIHKAATAESKKASLPETQQTQPTAQKIEPKAPDKTSQHEINKTAVIVGVVGLSALLLMAWR* |
| ⦗Top⦘ |