| Basic Information | |
|---|---|
| Taxon OID | 3300010020 Open in IMG/M |
| Scaffold ID | Ga0133900_1120481 Open in IMG/M |
| Source Dataset Name | Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #2 sample T2 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 541 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Belize: Carrie Bow Cay Field Station | |||||||
| Coordinates | Lat. (o) | 16.80288 | Long. (o) | -88.08213 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002131 | Metagenome / Metatranscriptome | 590 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0133900_11204812 | F002131 | N/A | VTNFVSEIKRVETYPDFEKLAYVIQYGVQGFIVKNIEGESTEEKDHSQVL* |
| ⦗Top⦘ |