Basic Information | |
---|---|
Taxon OID | 3300010020 Open in IMG/M |
Scaffold ID | Ga0133900_1008126 Open in IMG/M |
Source Dataset Name | Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #2 sample T2 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1339 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Belize: Carrie Bow Cay Field Station | |||||||
Coordinates | Lat. (o) | 16.80288 | Long. (o) | -88.08213 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047484 | Metagenome / Metatranscriptome | 149 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0133900_10081262 | F047484 | N/A | KDSRQNSGHSNFSYARYAEKFFTQIYRDLYGDAMLVHIRMGTNMAAGNQQKHLSLSFTTKT* |
⦗Top⦘ |