NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0133897_1053844

Scaffold Ga0133897_1053844


Overview

Basic Information
Taxon OID3300010019 Open in IMG/M
Scaffold IDGa0133897_1053844 Open in IMG/M
Source Dataset NameMicrobial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #1 sample T1
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)807
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Actiniaria → Edwardsiidae → Nematostella → Nematostella vectensis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Source Dataset Sampling Location
Location NameCarrie Bow Cay Field Station, Belize
CoordinatesLat. (o)16.80288Long. (o)-88.08213Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056319Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0133897_10538441F056319N/AHTTGAESKHWLGGPDMKYWPQQLNFAVFCATQGCGVSREIFDSGVDLPLQIRAFYIFHVYFTVRRILYQLGGIQSVSALPEDPTFNQFNNHYDVASYKRLCSEFGIDPASDFRFTRGANHGLGSIYIGVTGHGTMKTGVSYPGFDKFSDEGGSASKGNLISYIEQDDVAYAQADWFAPNKANGLTKAGLSRINQSIEAYVYCILGAQVNIRSSILGEGGRAKEAQTEFLVLMEGAIKQPDLAKSVQRYQLAVDEAMVRLNLAVAPNAW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.