Scaffold Ga0133903_1031350

Overview

Basic Information

• Taxon OID: 3300010017
• Scaffold ID: Ga0133903_1031350
• Source Dataset Name: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #3 sample H3
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 519
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Source Dataset Sampling Location

• Location Name: Carrie Bow Cay Field Station, Belize
• Coordinates
  • Lat. (^o): 16.80288
  • Long. (^o): -88.08213

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025646	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133903_10313501	F025646	GGTGG	MVSALVSGSSGPSSSPGRGHCVVFLGKTLYSHNASLHPGV