Basic Information | |
---|---|
Taxon OID | 3300010017 Open in IMG/M |
Scaffold ID | Ga0133903_1027719 Open in IMG/M |
Source Dataset Name | Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #3 sample H3 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 538 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Carrie Bow Cay Field Station, Belize | |||||||
Coordinates | Lat. (o) | 16.80288 | Long. (o) | -88.08213 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003577 | Metagenome / Metatranscriptome | 478 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0133903_10277191 | F003577 | GAG | LSKSRSAQGGLGYSFSLKVNWGYISAQKLESERSKSFAVSISLQTKAI |
⦗Top⦘ |