Scaffold Ga0105139_1020253

Overview

Basic Information

• Taxon OID: 3300009995
• Scaffold ID: Ga0105139_1020253
• Source Dataset Name: Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 987
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions

Source Dataset Sampling Location

• Location Name: Austin, Texas
• Coordinates
  • Lat. (^o): 30.387
  • Long. (^o): -97.7301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058613	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105139_10202531	F058613	AGGAG	LWFQLEKKSKEFELGLDAQKCFAQMHEDRNMNEGIGGQMMMLDPVVAQESRKERRAWKP*