Scaffold Ga0105030_125930

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105030_125930

Scaffold Ga0105030_125930

Overview

Basic Information
Taxon OID	3300009987 Open in IMG/M
Scaffold ID	Ga0105030_125930 Open in IMG/M
Source Dataset Name	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	539
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions

Source Dataset Sampling Location
Location Name	USA: Austin, Texas
Coordinates	Lat. (^o)	30.387	Long. (^o)	-97.7301	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004540	Metagenome / Metatranscriptome	433	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105030_1259301	F004540	N/A	EVTSGFFATNAPNPPHWTKNSCFGVLHSVGMHLGSFHNCMKLGAKWGELVQLMQKFVPRSHAGIFHNERTQSTPFYPKLMFWCVALCLGAFGIVS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.