Scaffold Ga0105030_101168

Overview

Basic Information

• Taxon OID: 3300009987
• Scaffold ID: Ga0105030_101168
• Source Dataset Name: Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2333
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions

Source Dataset Sampling Location

• Location Name: USA: Austin, Texas
• Coordinates
  • Lat. (^o): 30.387
  • Long. (^o): -97.7301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029283	Metagenome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105030_1011682	F029283	GGAGG	MAETMQADERPEEALSPGERKLAASRAALAELLGGDKGEADSFPRSNTMRFLMGGKGKMVAIGTFAGLLAVKPKLAFSLLRFLPLGRLLPLARALQNLR*