Scaffold Ga0105133_102853

Overview

Basic Information

• Taxon OID: 3300009981
• Scaffold ID: Ga0105133_102853
• Source Dataset Name: Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 980
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions

Source Dataset Sampling Location

• Location Name: Austin, Texas
• Coordinates
  • Lat. (^o): 30.387
  • Long. (^o): -97.7301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033293	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105133_1028531	F033293	N/A	MIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKILVDTG