Scaffold Ga0133780_1119139

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0133780_1119139

Scaffold Ga0133780_1119139

Overview

Basic Information
Taxon OID	3300009967 Open in IMG/M
Scaffold ID	Ga0133780_1119139 Open in IMG/M
Source Dataset Name	Termite gut microbial communities -laboratory nest Belgium. Combined Assembly of Gp0151224, Gp0151225, Gp0151226, Gp0151227
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Luxembourg Institute of Science and Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1796
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location
Location Name	Belgium
Coordinates	Lat. (^o)	50.814939	Long. (^o)	4.383499	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000253	Metagenome	1454	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133780_11191393	F000253	N/A	MEHPFLMFLDRTRRRGTVGGTPLDEWSARRGDLCLTAHDAHNGQVSVPSVGFE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.