Scaffold Ga0133780_1062396

Overview

Basic Information

• Taxon OID: 3300009967
• Scaffold ID: Ga0133780_1062396
• Source Dataset Name: Termite gut microbial communities -laboratory nest Belgium. Combined Assembly of Gp0151224, Gp0151225, Gp0151226, Gp0151227
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Luxembourg Institute of Science and Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 824
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location

• Location Name: Belgium
• Coordinates
  • Lat. (^o): 50.814939
  • Long. (^o): 4.383499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019385	Metagenome	230	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133780_10623961	F019385	N/A	VQNRAAKFANNINESGWETFAQCRLIARICTLFKAYTGRRAWKAIGDRLLKSCYLSRGDHNRKIRTRKQRTDVGKYSFVNRTIKSWNQLPASLLASFPCKLQIFRKRVKNVVTSKEIQVGIECKK*