Scaffold Ga0133736_1267708

Overview

Basic Information

• Taxon OID: 3300009966
• Scaffold ID: Ga0133736_1267708
• Source Dataset Name: Termite gut microbial communities. Combined Assembly of Gp0151149, Gp0151152, Gp0151222, Gp0151223
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Luxembourg, Luxembourg Institute of Science and Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1111
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location

• Location Name: France
• Coordinates
  • Lat. (^o): 48.913957
  • Long. (^o): 2.485499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000047	Metagenome	3366	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133736_12677081	F000047	N/A	GRGMWRIWGRGEVCTGFWWGNLRERDLWGDPDIDGRIILRWIFRKWEGVVWTGVGSR*