Scaffold Ga0117933_1030623

Overview

Basic Information

• Taxon OID: 3300009943
• Scaffold ID: Ga0117933_1030623
• Source Dataset Name: Combined Assembly of Gp0139325, Gp0139347, Gp0139348
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 866
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment → Stable Isotope Probing Incubations Of Microbial Communities From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.71538
  • Long. (^o): -110.73627
  • Depth (m): .01 to .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079345	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117933_10306232	F079345	GGAGG	MLPLALGLELDGLSVLQRKLLLEVLHRYPHYWSKFLSPKYGWQSQKETLEMFLQNHGTELVKEFAKAGLHGNGWKTARRSGVHVQG*