Scaffold Ga0131751_1006764

Overview

Basic Information

• Taxon OID: 3300009923
• Scaffold ID: Ga0131751_1006764
• Source Dataset Name: Microbial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S11
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1018
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location

• Location Name: Davies Reef, Great Barrier Reef, Australia
• Coordinates
  • Lat. (^o): -18.833
  • Long. (^o): 147.683

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041044	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131751_10067641	F041044	N/A	MPKSIEMALPVPTKSLLKTSPDEAMLFAPFGCTHQSPPAPPFLLTQNPSPKDIAGSDIMKLKVS*