| Basic Information | |
|---|---|
| Taxon OID | 3300009911 Open in IMG/M |
| Scaffold ID | Ga0132221_1009735 Open in IMG/M |
| Source Dataset Name | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, surface; RNA IDBA-UD |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 615 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Monogononta → Pseudotrocha → Ploima → Brachionidae → Brachionus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Falmouth, Massachusetts | |||||||
| Coordinates | Lat. (o) | 41.548517 | Long. (o) | -70.622961 | Alt. (m) | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022887 | Metagenome / Metatranscriptome | 212 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0132221_10097351 | F022887 | N/A | LIIYEILKFNLPKAHLNQSLKMPREHIHNHVLSRKLKKYYTLTLDKNNDGIVNWSDFEAAIENMVPKEDAEKNSRLKILRKRLEQNFQKYFWDLCAVGDANQDGVIDYDEWLDVMNDIVCHVKESKTFPEWYEGLHKALWRSNEFYDERDVQKEEFVNMMLTWEIDEAAAERAFAYLTEDGKKKMDYHLFQEFMKQFYTNEEAN |
| ⦗Top⦘ |