| Basic Information | |
|---|---|
| Taxon OID | 3300009906 Open in IMG/M |
| Scaffold ID | Ga0131753_114003 Open in IMG/M |
| Source Dataset Name | Microbial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S13 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 603 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Microbial → Sponge Microbes In A High Co2 World |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Davies Reef, Great Barrier Reef, Australia | |||||||
| Coordinates | Lat. (o) | -18.833 | Long. (o) | 147.683 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093358 | Metagenome / Metatranscriptome | 106 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0131753_1140031 | F093358 | N/A | DVSYKLMNLKIILLLIHCLVDMPTSQAQLSYLVMAERYRTVRVMVSEDR* |
| ⦗Top⦘ |