Scaffold Ga0131753_104482

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0131753_104482

Scaffold Ga0131753_104482

Overview

Basic Information
Taxon OID	3300009906 Open in IMG/M
Scaffold ID	Ga0131753_104482 Open in IMG/M
Source Dataset Name	Microbial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S13
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1023
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Microbial → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location
Location Name	Davies Reef, Great Barrier Reef, Australia
Coordinates	Lat. (^o)	-18.833	Long. (^o)	147.683	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010384	Metagenome / Metatranscriptome	304	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131753_1044822	F010384	GAG	MQPQLGIWKRFIRSLFRVDRCSLSWASGRGLLEVYWGWTDAASAGDLEEVY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.