NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0131759_125861

Scaffold Ga0131759_125861


Overview

Basic Information
Taxon OID3300009904 Open in IMG/M
Scaffold IDGa0131759_125861 Open in IMG/M
Source Dataset NameMicrobial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)508
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location
Location NameDavies Reef, Great Barrier Reef, Australia
CoordinatesLat. (o)-18.833Long. (o)147.683Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013612Metagenome / Metatranscriptome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0131759_1258611F013612GAGMSLSAMSLGLRFCVNRKGGTRGGVWVHPKGVNSMAVSGLVFRSDLVGTGRVISVLFGINRVRNKRSHLVGPPFPEFKARFSATAGWHFSRDLTRRLLIGGCGQS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.