NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0131758_121693

Scaffold Ga0131758_121693


Overview

Basic Information
Taxon OID3300009901 Open in IMG/M
Scaffold IDGa0131758_121693 Open in IMG/M
Source Dataset NameMicrobial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)511
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location
Location NameDavies Reef, Great Barrier Reef, Australia
CoordinatesLat. (o)-18.833Long. (o)147.683Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015565Metagenome / Metatranscriptome253Y

Sequences

Protein IDFamilyRBSSequence
Ga0131758_1216932F015565N/AMLLFCSKTIVKESRKFELARLKKKKEKHFGRLATVWFGAFAMLCSATGCVFRHENTRK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.