Scaffold Ga0131754_107218

Overview

Basic Information

• Taxon OID: 3300009899
• Scaffold ID: Ga0131754_107218
• Source Dataset Name: Microbial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S14
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 887
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location

• Location Name: Davies Reef, Great Barrier Reef, Australia
• Coordinates
  • Lat. (^o): -18.833
  • Long. (^o): 147.683

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083784	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131754_1072181	F083784	N/A	MDFNGTPFEVTMAAGTTVVTADIPIVDDEITEAEEVFVVVLEVFSNTTNQVEFTTQTTVCRIPQSDRKHHKTCSI