Scaffold Ga0131077_10001061

Overview

Basic Information

• Taxon OID: 3300009873
• Scaffold ID: Ga0131077_10001061
• Source Dataset Name: Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Novogene Bioinformatics Technology Co., Ltd
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 75533
• Total Scaffold Genes: 98
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 59 (60.20%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan

Source Dataset Sampling Location

• Location Name: Tai Wan
• Coordinates
  • Lat. (^o): 24.0
  • Long. (^o): 120.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037108	Metagenome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131077_1000106128	F037108	AGGA	VTAPADAEAWALVEGELSHHAKAGDGWIETLNRLWRKNRFVTSLDGVLKLAFEPPVLTREMLSATRERWPLERLAPLVHADAHGRARPKVDELPVLVLEWRGRHFLIDGLNRINRRVRTRDPGPHEVIVIHARTAA*