| Basic Information | |
|---|---|
| Taxon OID | 3300009872 Open in IMG/M |
| Scaffold ID | Ga0130079_14430611 Open in IMG/M |
| Source Dataset Name | Cow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Switchgrass. Combined Assembly of Gp0148675, Gp0148676 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | U.S. Department of Energy (DOE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 713 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Cow Rumen Metatranscriptome |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Illinois at Urbana - Champaign, Illinois, USA | |||||||
| Coordinates | Lat. (o) | 40.096 | Long. (o) | -88.2315 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011198 | Metagenome / Metatranscriptome | 294 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0130079_144306111 | F011198 | N/A | FQKTFFIQEKETGDKFFRTTRVGSCRKVVVKNGLPFALTFKVKNPRGEPMTHFNYTLKQYPKNPSSYFIDYCTRKQECHLGMDKKPLIPYNPNHTRSQLPNDIGFRVIRNLSAFDIGKEGLINRKQWISTYKDSFRPSSVKRISNPGILSDMAKRTHYKLNNIEYA* |
| ⦗Top⦘ |