Scaffold Ga0130079_14377297

Overview

Basic Information

• Taxon OID: 3300009872
• Scaffold ID: Ga0130079_14377297
• Source Dataset Name: Cow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Switchgrass. Combined Assembly of Gp0148675, Gp0148676
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: U.S. Department of Energy (DOE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 783
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Cow Rumen Metatranscriptome

Source Dataset Sampling Location

• Location Name: University of Illinois at Urbana - Champaign, Illinois, USA
• Coordinates
  • Lat. (^o): 40.096
  • Long. (^o): -88.2315

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013054	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0130079_143772971	F013054	N/A	LDVSGGQSLVDVGNSVDLILKGSFFVLVKVDLLDNRAVELVSVSSSDDGSRLAKVFKKSIIDSSQSSVSGSLLRSVGLDPLGLDGSLGSDENVGLKSLFKFGDELSMGSVGNSVAGIRNVDDDDVLLLTLADDFDFSGVSDEKVLDGVLKIRDAVLDFEEGLSDGFFNNGGVGGDGLVELRLVVGHDDLSGRCGL*