Basic Information | |
---|---|
Taxon OID | 3300009872 Open in IMG/M |
Scaffold ID | Ga0130079_10296087 Open in IMG/M |
Source Dataset Name | Cow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Switchgrass. Combined Assembly of Gp0148675, Gp0148676 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | U.S. Department of Energy (DOE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 991 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Cow Rumen Metatranscriptome |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Illinois at Urbana - Champaign, Illinois, USA | |||||||
Coordinates | Lat. (o) | 40.096 | Long. (o) | -88.2315 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020820 | Metagenome / Metatranscriptome | 222 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0130079_102960871 | F020820 | N/A | MSSNISQILSSKENTSFNLSFLVNIGASRWFTGENKLNISSLNSDFKTQLPKSQVFEISSMIFNIPKHKNEILSKYKCYFDEQSNTLTLIINENISFSEFTKEIMMNLFTFTQKVGIDTICFLIDKKNHGYGRIIQDLMIVGFKSNEKKNEIKIGGNVYKIMEIKANSDEEIKEFFF* |
⦗Top⦘ |