| Basic Information | |
|---|---|
| Taxon OID | 3300009870 Open in IMG/M |
| Scaffold ID | Ga0131092_10078367 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7311 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tai Wan | |||||||
| Coordinates | Lat. (o) | 25.0 | Long. (o) | 121.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006745 | Metagenome | 365 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0131092_100783676 | F006745 | GGA | MRTARHAPRTSSAVVIYVIVLVAFQVFLLTVAVEAFAHDDERLAWASATVSVVMAGGSALLYRYLRP* |
| ⦗Top⦘ |