Scaffold Ga0130016_10339428

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0130016_10339428

Scaffold Ga0130016_10339428

Overview

Basic Information
Taxon OID	3300009868 Open in IMG/M
Scaffold ID	Ga0130016_10339428 Open in IMG/M
Source Dataset Name	Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Novogene Bioinformatics Technology Co., Ltd
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1028
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → unclassified Syntrophomonadaceae → Syntrophomonadaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Community In Wastewater Treatment Plant From Tai Wan

Source Dataset Sampling Location
Location Name	Taiwan
Coordinates	Lat. (^o)	25.0	Long. (^o)	121.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079824	Metagenome / Metatranscriptome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0130016_103394282	F079824	GGAGG	MIYGFFGSIPGCPHNRGNHALRGNGKTLCLTFVGYLDHLAGRHVISNYQTSFSELVSTEKIAEMVIYEDIRDTTILISELQLYMNSLGVNTKELRNFVGSVIGQSRKRNTDIHYDTQRYTDVHPRIRVQTDRAFLPRKFHEDGKPCQLDRCNKKHIIYLFQHDPYLEQPIIKLRAD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.