Basic Information | |
---|---|
Taxon OID | 3300009868 Open in IMG/M |
Scaffold ID | Ga0130016_10001096 Open in IMG/M |
Source Dataset Name | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 56865 |
Total Scaffold Genes | 29 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (34.48%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Community In Wastewater Treatment Plant From Tai Wan |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Taiwan | |||||||
Coordinates | Lat. (o) | 25.0 | Long. (o) | 121.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063287 | Metagenome | 129 | N |
F102365 | Metagenome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0130016_1000109621 | F063287 | N/A | VIRALPQQRNRVIVSSASRNQQFTGVNWNGTPTRPIFALVRTQSGERPLGAEGYDLLGHEGRHAAYGDRKLFRHAIDSGIDQANELLFPGMVPTMGAGLLAIWLVRKSGEQLTFKDTLKIKELILAQPELLNGWCEVETDLFNPENRSYRVFAEPDPAVLKRIVKAATQS* |
Ga0130016_1000109625 | F102365 | AGAAG | MLKWLFRKSAPAPPENQGEVRRRLQAAQRLVRQQKESKDAPEIPKQGPPGNCAREILPSNGPDAAISYRLPSPPPARSTLAAALESILQGRRVNPELFTQLYRGGFVFKDPHGRWAITEMGKGLIEQNKLFLPDRCLVDGVECASGWNQ* |
⦗Top⦘ |