Scaffold Ga0131806_1036724

Overview

Basic Information

• Taxon OID: 3300009855
• Scaffold ID: Ga0131806_1036724
• Source Dataset Name: Hot spring soil microbial communities from Dewar Creek, Kimberly, BC, Canada ? 2012, Sample 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Calgary
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 724
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Soil → Wastewater Microbial Communities From Base Mine Lake, Ft. Mcmurray, Alberta, Canada - Surface, May 2015

Source Dataset Sampling Location

• Location Name: Kimberly, British Columbia, Canada
• Coordinates
  • Lat. (^o): 49.9543667
  • Long. (^o): -116.5155
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076975	Metagenome / Metatranscriptome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0131806_10367241	F076975	N/A	VGGYHRVGDSNYFGAAPALFCGQRGGNLRAEVIPSYSAADIARPAETVLVVEALSFEYGMTCRLRVPAPKDAVDALSPYYGLNYAPRLLGEYQTRNGYRYREGQGFVVCVDGHARRLRHTERMMIISHRADGTPYYRRQYARE*