| Basic Information | |
|---|---|
| Taxon OID | 3300009854 Open in IMG/M |
| Scaffold ID | Ga0131850_1028947 Open in IMG/M |
| Source Dataset Name | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 78 mira |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Center for Advanced Technologies in Genomics, Sao Paulo University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1132 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sao Paulo Zoo, Brazil | |||||||
| Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078430 | Metagenome | 116 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0131850_10289472 | F078430 | N/A | VEGAALMATMLGGVVLPSVYVQEMEPDWVGKLIRRWTLRTRPLTWEQYAAIEXMVXEVGXARXIERAVDGTPHVLGASQVALILDEGGGRTTTAMVYITAYRVDRPLSLSQRREIELQLEEA* |
| ⦗Top⦘ |