Scaffold Ga0116223_10242268

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116223_10242268

Scaffold Ga0116223_10242268

Overview

Basic Information
Taxon OID	3300009839 Open in IMG/M
Scaffold ID	Ga0116223_10242268 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1090
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location Name	Germany: Weissenstadt
Coordinates	Lat. (^o)	50.1318	Long. (^o)	11.881	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056644	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116223_102422682	F056644	AGGAGG	MYVLIRYPVGIIVEAVVLAKGKNRMRVALAGFPDTIELRRSGSQWLAATRQPIEFDFVMSNAHQDESVSFSMPARVALAAATGSAAFPQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.