| Basic Information | |
|---|---|
| Taxon OID | 3300009813 Open in IMG/M |
| Scaffold ID | Ga0105057_1001342 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2846 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Columbia River, Washington | |||||||
| Coordinates | Lat. (o) | 46.372 | Long. (o) | -119.272 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013076 | Metagenome / Metatranscriptome | 274 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105057_10013422 | F013076 | N/A | LTAVYGGSKSLIDPVVLLYMFGTTYPIFDAQGIVSEYVRNPDLADYVRWEYRPADRSSVIRSIKRSATATRRRVRFAGARRLARRLRAWVKAVRETPGGSIESGLVYRAMLREKVL* |
| ⦗Top⦘ |