| Basic Information | |
|---|---|
| Taxon OID | 3300009794 Open in IMG/M |
| Scaffold ID | Ga0105189_1001344 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2399 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → Virus sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Atlantic ocean | |||||||
| Coordinates | Lat. (o) | -9.4986 | Long. (o) | -25.9999 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000613 | Metagenome / Metatranscriptome | 985 | Y |
| F002192 | Metagenome / Metatranscriptome | 585 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105189_10013442 | F000613 | AGGAG | MPLVKKRLSVAAGATSDQVLAGTTYEYVDPGTRIVVASAVDTAGTATADTTMDFTVNNAEFSKNASVSALVTGEPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTSGTRTIDVAVFIGG* |
| Ga0105189_10013444 | F002192 | N/A | MHQVLLYSTFFIAILALFFGLYACGRVAKVQTAVKDLDWDAVANMTGDLATTKRTIQTLNNRINGMHSPKLQEQELMLQLLQNQGQKTNGKMVGG* |
| ⦗Top⦘ |