| Basic Information | |
|---|---|
| Taxon OID | 3300009790 Open in IMG/M |
| Scaffold ID | Ga0115012_10044707 Open in IMG/M |
| Source Dataset Name | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2935 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tropical Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 2.405 | Long. (o) | -13.602 | Alt. (m) | Depth (m) | 80 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009762 | Metagenome / Metatranscriptome | 313 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115012_100447072 | F009762 | AGGA | MRKNWHKNFFIETDYKVPIDFWDDYFNGKWEDSNKLYSEYVDDATDGKQMNKFYVQGIHNFDRKLLRLIKHIWNQFGFRPKEFRCNFFRVLEGGELPLHSDVKSKCSFVKPITENTGELYFDDGTDNASILYDSMVVLNTKKPHGVRSPSKERIVFHMGIHDVEFEKLK* |
| ⦗Top⦘ |