| Basic Information | |
|---|---|
| Taxon OID | 3300009789 Open in IMG/M |
| Scaffold ID | Ga0126307_10017852 Open in IMG/M |
| Source Dataset Name | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5301 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UC McLaughlin Reserve (Lake County, CA) | |||||||
| Coordinates | Lat. (o) | 38.8692 | Long. (o) | -122.4283 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037924 | Metagenome / Metatranscriptome | 167 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126307_100178525 | F037924 | AGGA | MAASKLKFVIFRDLKDGYRWRLSSATGETVERSERGHRHKGECAQEVFRLKGDRYHHAKVLDAAIG* |
| ⦗Top⦘ |