Scaffold Ga0116157_10074011

Overview

Basic Information

• Taxon OID: 3300009782
• Scaffold ID: Ga0116157_10074011
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2111
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.12
  • Long. (^o): -87.64

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007038	Metagenome / Metatranscriptome	359	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116157_100740112	F007038	N/A	MARRIFVDTEWTAAPWLAHAELMWIGLADEDGGSWFGISAEVAIDPVANPFMSGVFRLIRPEEPRMPRLQLRDAVIDFCGDVQEFWAWIPTLDSFARSSGLGDEARTLFDRCWDIDLQMLCALVQPWPAAWPTTLHDLNAAAAAAGVAIPPRAPNHLHPRVHAEWNRQLFDRIRAAGTL*