Scaffold Ga0116178_10423256

Overview

Basic Information

• Taxon OID: 3300009781
• Scaffold ID: Ga0116178_10423256
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 650
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa → unclassified Candidatus Methanofastidiosa → Candidatus Methanofastidiosa archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.84
  • Long. (^o): -87.68

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074119	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116178_104232561	F074119	N/A	MSEIQVFEVLAKILPYLVSLGIGAFAGWELVKTKIHELAEFFKTVDEALYDDAVTEKEFRAIWEKGRSLFELGLIQEKGKV*